PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000907489
Common NameNAC13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 542aa    MW: 60565.1 Da    PI: 5.2002
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000907489genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.57.8e-5191361128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    lp GfrF+Ptd el+++yL+ k++g++ ++  vi+e+d++k ePwdLp  + +++++ ew+fF+++d+ky++g+r nrat +gyWkatgkd++++s
  MDP0000907489   9 LPLGFRFRPTDAELIDYYLRSKINGNHRQV-AVIREIDVCKREPWDLPdlSVIQTTDPEWFFFCPQDRKYPNGHRLNRATIRGYWKATGKDRQIKS 103
                    699************************999.89**************96447778888************************************** PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ l+g+kktLvf+ grapkg++t+Wvmheyr+
  MDP0000907489 104 -DKILIGMKKTLVFHIGRAPKGKRTNWVMHEYRA 136
                    .99*****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-594159IPR003441NAC domain
PROSITE profilePS5100554.5979159IPR003441NAC domain
PfamPF023652.3E-2610135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MEVLSMNSLP LGFRFRPTDA ELIDYYLRSK INGNHRQVAV IREIDVCKRE PWDLPDLSVI  60
QTTDPEWFFF CPQDRKYPNG HRLNRATIRG YWKATGKDRQ IKSDKILIGM KKTLVFHIGR  120
APKGKRTNWV MHEYRATQKE LDGTNPGQSS FVLCRLFKKQ DETIEDSNFD EAEPTASSSI  180
AVVSSPQDVQ SDLAPVPTSP SFERQDEKPL TKVECTSADT GNAMGSDTLP PLPTTKFPSN  240
SCDGYDAECQ LNMPLGELDM FYDPPQEPLF SPLHSQMHAE LGYYGRNDFS NDHQGVTFPY  300
GTNEQDAYVS DFLSSILNSS GEQIDVDAIA AEVPFVKELQ NDVQPEENID RNDPSLLISI  360
PEDYDQSSRS EVTSNHVNAI INRDAGTGIR LRARQTQIPT SAENFVTQGD AKRRIRLATK  420
VRRIQCSSRP EDNEPKPIAM EEMSNNEKKP IGAVDTNVIS ADIDLPEKGT VPKRPNFTTD  480
GSIITGKRLL SVLLKAVSPA GHSMWSLAFL FIGVVVAFLF IILRAHGDFI SFEAARRPFA  540
A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-45416015169NAC domain-containing protein 19
3swp_C5e-45416015169NAC domain-containing protein 19
3swp_B5e-45416015169NAC domain-containing protein 19
3swp_A5e-45416015169NAC domain-containing protein 19
3swm_D5e-45416015169NAC domain-containing protein 19
3swm_C5e-45416015169NAC domain-containing protein 19
3swm_B5e-45416015169NAC domain-containing protein 19
3swm_A5e-45416015169NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.36810.0bud| fruit| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280863.10.0uncharacterized LOC103439966
TrEMBLD9ZJ910.0D9ZJ91_MALDO; NAC domain class transcription factor
STRINGGLYMA02G38710.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.21e-104TCV-interacting protein